Lineage for d1pjuc2 (1pju C:2-15,C:75-115)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038566Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 3038567Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 3038568Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins)
  6. 3038579Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
    two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain
  7. 3038580Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries)
  8. 3038586Domain d1pjuc2: 1pju C:2-15,C:75-115 [94789]
    complexed with so4

Details for d1pjuc2

PDB Entry: 1pju (more details), 2.15 Å

PDB Description: Unbound form of Tomato Inhibitor-II
PDB Compounds: (C:) Wound-induced proteinase inhibitor II

SCOPe Domain Sequences for d1pjuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjuc2 g.69.1.1 (C:2-15,C:75-115) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
actrecgnlgfgicXrsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdep

SCOPe Domain Coordinates for d1pjuc2:

Click to download the PDB-style file with coordinates for d1pjuc2.
(The format of our PDB-style files is described here.)

Timeline for d1pjuc2: