![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily) disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III |
![]() | Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) ![]() |
![]() | Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins) |
![]() | Protein Wound-induced proteinase inhibitor-II [90168] (1 species) two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain |
![]() | Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries) |
![]() | Domain d1pjuc2: 1pju C:2-15,C:75-115 [94789] complexed with so4 |
PDB Entry: 1pju (more details), 2.15 Å
SCOPe Domain Sequences for d1pjuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjuc2 g.69.1.1 (C:2-15,C:75-115) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]} actrecgnlgfgicXrsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdep
Timeline for d1pjuc2: