Lineage for d1pjnb_ (1pjn B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332717Protein Importin alpha [48376] (1 species)
  7. 2332718Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2332733Domain d1pjnb_: 1pjn B: [94765]
    complexed with a bipartite NLS peptide, chain A

Details for d1pjnb_

PDB Entry: 1pjn (more details), 2.5 Å

PDB Description: Mouse Importin alpha-bipartite NLS N1N2 from Xenopus laevis phosphoprotein Complex
PDB Compounds: (B:) importin alpha-2 subunit

SCOPe Domain Sequences for d1pjnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjnb_ a.118.1.1 (B:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyfs

SCOPe Domain Coordinates for d1pjnb_:

Click to download the PDB-style file with coordinates for d1pjnb_.
(The format of our PDB-style files is described here.)

Timeline for d1pjnb_: