Lineage for d1pj7a1 (1pj7 A:743-830)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127171Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1127268Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) (S)
  5. 1127269Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 1127285Protein N,N-dimethylglycine oxidase, C-terminal domain [101792] (1 species)
  7. 1127286Species Arthrobacter globiformis [TaxId:1665] [101793] (3 PDB entries)
  8. 1127289Domain d1pj7a1: 1pj7 A:743-830 [94750]
    Other proteins in same PDB: d1pj7a2, d1pj7a3, d1pj7a4
    complexed with fad, ffo, na

Details for d1pj7a1

PDB Entry: 1pj7 (more details), 2.1 Å

PDB Description: structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid
PDB Compounds: (A:) N,N-dimethylglycine oxidase

SCOPe Domain Sequences for d1pj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj7a1 b.44.2.1 (A:743-830) N,N-dimethylglycine oxidase, C-terminal domain {Arthrobacter globiformis [TaxId: 1665]}
arrlrcltiddgrsivlgkepvfykeqavgyvtsaaygytvakpiaysylpgtvsvgdsv
dieyfgrritatvtedplydpkmtrlrg

SCOPe Domain Coordinates for d1pj7a1:

Click to download the PDB-style file with coordinates for d1pj7a1.
(The format of our PDB-style files is described here.)

Timeline for d1pj7a1: