![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) ![]() |
![]() | Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (2 proteins) |
![]() | Protein N,N-dimethylglycine oxidase, C-terminal domain [101792] (1 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [101793] (3 PDB entries) |
![]() | Domain d1pj7a1: 1pj7 A:743-830 [94750] Other proteins in same PDB: d1pj7a2, d1pj7a3, d1pj7a4 complexed with fad, fon, na |
PDB Entry: 1pj7 (more details), 2.1 Å
SCOP Domain Sequences for d1pj7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pj7a1 b.44.2.1 (A:743-830) N,N-dimethylglycine oxidase, C-terminal domain {Arthrobacter globiformis} arrlrcltiddgrsivlgkepvfykeqavgyvtsaaygytvakpiaysylpgtvsvgdsv dieyfgrritatvtedplydpkmtrlrg
Timeline for d1pj7a1: