Lineage for d1pgl22 (1pgl 2:183-370)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569151Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 569256Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 569531Family b.121.4.2: Comoviridae-like VP [88636] (2 proteins)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 569532Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
    chain 1 is one-domain VP23; chain 2 is two-domain VP37
  7. 569533Species BPMV (Bean pod mottle virus) [TaxId:12260] [49628] (3 PDB entries)
  8. 569536Domain d1pgl22: 1pgl 2:183-370 [94692]

Details for d1pgl22

PDB Entry: 1pgl (more details), 2.8 Å

PDB Description: bean pod mottle virus (bpmv), middle component

SCOP Domain Sequences for d1pgl22:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgl22 b.121.4.2 (2:183-370) Comovirus coat proteins (VP37 and VP23) {BPMV (Bean pod mottle virus)}
cvlnpqnpfvlnrwmgkltfpqgtsrsvkrmplsigggagaksailmnmpnavlsmwryf
vgdlvfevskmtspyikctvsffiafgnladdtinfeafphklvqfgeiqekvvlkfsqe
efltawstqvrpattlladgcpylyamvhdssvstipgdfvigvkltiienmcayglnpg
isgsrllg

SCOP Domain Coordinates for d1pgl22:

Click to download the PDB-style file with coordinates for d1pgl22.
(The format of our PDB-style files is described here.)

Timeline for d1pgl22:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgl21
View in 3D
Domains from other chains:
(mouse over for more information)
d1pgl11