| Class b: All beta proteins [48724] (141 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) ![]() |
| Family b.121.4.2: Comoviridae-like VP [88636] (2 proteins) duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains |
| Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species) chain 1 is one-domain VP23; chain 2 is two-domain VP37 |
| Species BPMV (Bean pod mottle virus) [TaxId:12260] [49628] (3 PDB entries) |
| Domain d1pgl22: 1pgl 2:183-370 [94692] |
PDB Entry: 1pgl (more details), 2.8 Å
SCOP Domain Sequences for d1pgl22:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgl22 b.121.4.2 (2:183-370) Comovirus coat proteins (VP37 and VP23) {BPMV (Bean pod mottle virus)}
cvlnpqnpfvlnrwmgkltfpqgtsrsvkrmplsigggagaksailmnmpnavlsmwryf
vgdlvfevskmtspyikctvsffiafgnladdtinfeafphklvqfgeiqekvvlkfsqe
efltawstqvrpattlladgcpylyamvhdssvstipgdfvigvkltiienmcayglnpg
isgsrllg
Timeline for d1pgl22: