SCOP 1.67: Domain d1pgl22: 1pgl 2:183-370

Lineage for d1pgl22 (1pgl 2:183-370)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (2 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
   chain 1 is one-domain VP23; chain 2 is two-domain VP37

7. Species BPMV (Bean pod mottle virus) [TaxId:12260] [49628] (3 PDB entries)

8. Domain d1pgl22: 1pgl 2:183-370 [94692]

Details for d1pgl22

PDB Entry: 1pgl, 2.8 Å

PDB Description: bean pod mottle virus (bpmv), middle component

SCOP Domain Sequences for d1pgl22:

Sequence; same for both SEQRES and ATOM records:

>d1pgl22 b.121.4.2 (2:183-370) Comovirus coat proteins (VP37 and VP23) {BPMV (Bean pod mottle virus)}
cvlnpqnpfvlnrwmgkltfpqgtsrsvkrmplsigggagaksailmnmpnavlsmwryf
vgdlvfevskmtspyikctvsffiafgnladdtinfeafphklvqfgeiqekvvlkfsqe
efltawstqvrpattlladgcpylyamvhdssvstipgdfvigvkltiienmcayglnpg
isgsrllg

Timeline for d1pgl22:

• d1pgl22 is new in SCOP 1.67
  
• d1pgl22 appears in SCOP 1.69
  
• d1pgl22 appears in the current release, SCOPe 2.08