Lineage for d1pg2a1 (1pg2 A:389-550)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705922Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 2705951Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 2705952Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)
  8. 2705955Domain d1pg2a1: 1pg2 A:389-550 [94671]
    Other proteins in same PDB: d1pg2a2
    protein/RNA complex; complexed with adn, met

Details for d1pg2a1

PDB Entry: 1pg2 (more details), 1.75 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with methionine and adenosine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pg2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg2a1 a.27.1.1 (A:389-550) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaskeev

SCOPe Domain Coordinates for d1pg2a1:

Click to download the PDB-style file with coordinates for d1pg2a1.
(The format of our PDB-style files is described here.)

Timeline for d1pg2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pg2a2