![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species) this domain follows the Rossmann-fold catalytic domain of class I aaRS |
![]() | Species Escherichia coli [TaxId:562] [47327] (9 PDB entries) |
![]() | Domain d1pg2a1: 1pg2 A:389-550 [94671] Other proteins in same PDB: d1pg2a2 protein/RNA complex; complexed with adn, met |
PDB Entry: 1pg2 (more details), 1.75 Å
SCOPe Domain Sequences for d1pg2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pg2a1 a.27.1.1 (A:389-550) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt eltwdgiqqpllghkvnpfkalynridmrqvealveaskeev
Timeline for d1pg2a1: