SCOPe 2.08: Domain d1pa1a1: 1pa1 A:501-798

Lineage for d1pa1a1 (1pa1 A:501-798)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d1pa1a1: 1pa1 A:501-798 [94404]
   Other proteins in same PDB: d1pa1a2
   complexed with cl, mg; mutant

Details for d1pa1a1

PDB Entry: 1pa1, 1.6 Å

PDB Description: crystal structure of the c215d mutant of protein tyrosine phosphatase 1b

PDB Compounds: (A:) protein-tyrosine phosphatase, non-receptor type 1

SCOPe Domain Sequences for d1pa1a1:

Sequence; same for both SEQRES and ATOM records:

>d1pa1a1 c.45.1.2 (A:501-798) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhdsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

Timeline for d1pa1a1:

• d1pa1a1 first appeared in SCOP 1.67, called d1pa1a_
  
• d1pa1a1 appears in SCOPe 2.07