Lineage for d1p9ds_ (1p9d S:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651950Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)
  4. 2651951Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family) (S)
  5. 2651952Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
    amphipathic helix
  6. 2651953Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)
  7. 2651954Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)
  8. 2651956Domain d1p9ds_: 1p9d S: [94387]
    Other proteins in same PDB: d1p9du_

Details for d1p9ds_

PDB Entry: 1p9d (more details)

PDB Description: high-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a
PDB Compounds: (S:) 26S proteasome non-ATPase regulatory subunit 4

SCOPe Domain Sequences for d1p9ds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ds_ j.105.1.1 (S:) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens) [TaxId: 9606]}
fgrtglpdlssmteeeqiayamqmslqgaefg

SCOPe Domain Coordinates for d1p9ds_:

Click to download the PDB-style file with coordinates for d1p9ds_.
(The format of our PDB-style files is described here.)

Timeline for d1p9ds_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p9du_