SCOPe 2.08: Domain d1p9ds_: 1p9d S:

Lineage for d1p9ds_ (1p9d S:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)

4. Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family)

5. Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
   amphipathic helix

6. Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)

8. Domain d1p9ds_: 1p9d S: [94387]
   Other proteins in same PDB: d1p9du_

Details for d1p9ds_

PDB Entry: 1p9d

PDB Description: high-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a

PDB Compounds: (S:) 26S proteasome non-ATPase regulatory subunit 4

SCOPe Domain Sequences for d1p9ds_:

Sequence; same for both SEQRES and ATOM records:

>d1p9ds_ j.105.1.1 (S:) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens) [TaxId: 9606]}
fgrtglpdlssmteeeqiayamqmslqgaefg

Timeline for d1p9ds_:

• d1p9ds_ first appeared in SCOP 1.67
  
• d1p9ds_ appears in SCOPe 2.07