Lineage for d1p81d1 (1p81 D:598-753)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589414Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 1589415Protein Catalase, C-terminal domain [52329] (2 species)
  7. 1589416Species Escherichia coli, HPII [TaxId:562] [52330] (16 PDB entries)
  8. 1589428Domain d1p81d1: 1p81 D:598-753 [94351]
    Other proteins in same PDB: d1p81a2, d1p81b2, d1p81c2, d1p81d2
    complexed with hdd

Details for d1p81d1

PDB Entry: 1p81 (more details), 1.81 Å

PDB Description: crystal structure of the d181e variant of catalase hpii from e. coli
PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d1p81d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p81d1 c.23.16.3 (D:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d1p81d1:

Click to download the PDB-style file with coordinates for d1p81d1.
(The format of our PDB-style files is described here.)

Timeline for d1p81d1: