SCOPe 2.03: Domain d1p81d1: 1p81 D:598-753

Lineage for d1p81d1 (1p81 D:598-753)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (2 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (16 PDB entries)

8. Domain d1p81d1: 1p81 D:598-753 [94351]
   Other proteins in same PDB: d1p81a2, d1p81b2, d1p81c2, d1p81d2
   complexed with hdd

Details for d1p81d1

PDB Entry: 1p81, 1.81 Å

PDB Description: crystal structure of the d181e variant of catalase hpii from e. coli

PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d1p81d1:

Sequence; same for both SEQRES and ATOM records:

>d1p81d1 c.23.16.3 (D:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d1p81d1:

• d1p81d1 first appeared in SCOP 1.67
  
• d1p81d1 appears in SCOPe 2.02
  
• d1p81d1 appears in SCOPe 2.04
  
• d1p81d1 appears in the current release, SCOPe 2.08