Lineage for d1p7ra_ (1p7r A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1094814Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1094979Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1094980Species Pseudomonas putida [TaxId:303] [48267] (94 PDB entries)
    Uniprot P00183
  8. 1095096Domain d1p7ra_: 1p7r A: [94317]
    complexed with hem, nct

Details for d1p7ra_

PDB Entry: 1p7r (more details), 2.85 Å

PDB Description: crystal structure of reduced, co-exposed complex of cytochrome p450cam with (s)-(-)-nicotine
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d1p7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ra_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhh

SCOPe Domain Coordinates for d1p7ra_:

Click to download the PDB-style file with coordinates for d1p7ra_.
(The format of our PDB-style files is described here.)

Timeline for d1p7ra_: