Lineage for d1p7ra1 (1p7r A:10-414)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005304Domain d1p7ra1: 1p7r A:10-414 [94317]
    Other proteins in same PDB: d1p7ra2
    complexed with hem, nct

Details for d1p7ra1

PDB Entry: 1p7r (more details), 2.85 Å

PDB Description: crystal structure of reduced, co-exposed complex of cytochrome p450cam with (s)-(-)-nicotine
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d1p7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ra1 a.104.1.1 (A:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d1p7ra1:

Click to download the PDB-style file with coordinates for d1p7ra1.
(The format of our PDB-style files is described here.)

Timeline for d1p7ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7ra2