SCOPe 2.08: Domain d1p7ho2: 1p7h O:393-575

Lineage for d1p7ho2 (1p7h O:393-575)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d1p7ho2: 1p7h O:393-575 [94278]
   Other proteins in same PDB: d1p7hl1, d1p7hm1, d1p7hn1, d1p7ho1
   protein/DNA complex

Details for d1p7ho2

PDB Entry: 1p7h, 2.6 Å

PDB Description: structure of nfat1 bound as a dimer to the hiv-1 ltr kb element

PDB Compounds: (O:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1p7ho2:

Sequence; same for both SEQRES and ATOM records:

>d1p7ho2 b.2.5.3 (O:393-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
sah

Timeline for d1p7ho2:

• d1p7ho2 first appeared in SCOP 1.67
  
• d1p7ho2 appears in SCOPe 2.07