PDB entry 1p7h

View 1p7h on RCSB PDB site
Description: Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
Class: Transcription/DNA
Keywords: DNA Binding protein, Transcription regulation, Activator, Transcription-DNA COMPLEX
Deposited on 2003-05-01, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*ap*ap*tp*gp*gp*gp*gp*ap*cp*tp*tp*tp*cp*cp*a)-3'
  • Chain 'B':
    Compound: 5'-d(*tp*tp*tp*gp*gp*ap*ap*ap*gp*tp*cp*cp*cp*cp*a)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*ap*tp*gp*gp*gp*gp*ap*cp*tp*tp*tp*cp*cp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*tp*tp*gp*gp*ap*ap*ap*gp*tp*cp*cp*cp*cp*a)-3'
  • Chain 'L':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (0-285)
      • conflict (1-2)
    Domains in SCOPe 2.07: d1p7hl1, d1p7hl2
  • Chain 'M':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (0-285)
      • conflict (1-2)
    Domains in SCOPe 2.07: d1p7hm1, d1p7hm2
  • Chain 'N':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (0-285)
      • conflict (1-2)
    Domains in SCOPe 2.07: d1p7hn1, d1p7hn2
  • Chain 'O':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2 OR NFAT1 OR NFATP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13469 (0-285)
      • conflict (1-2)
    Domains in SCOPe 2.07: d1p7ho1, d1p7ho2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7hL (L:)
    ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
    plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
    idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
    sahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdk
    sqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7hM (M:)
    ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
    plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
    idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
    sahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdk
    sqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7hN (N:)
    ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
    plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
    idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
    sahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdk
    sqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7hO (O:)
    ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
    plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
    idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
    sahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdk
    sqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv