Lineage for d1p7ho2 (1p7h O:393-575)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378076Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 2378077Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 2378089Domain d1p7ho2: 1p7h O:393-575 [94278]
    Other proteins in same PDB: d1p7hl1, d1p7hm1, d1p7hn1, d1p7ho1
    protein/DNA complex

Details for d1p7ho2

PDB Entry: 1p7h (more details), 2.6 Å

PDB Description: structure of nfat1 bound as a dimer to the hiv-1 ltr kb element
PDB Compounds: (O:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1p7ho2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ho2 b.2.5.3 (O:393-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
sah

SCOPe Domain Coordinates for d1p7ho2:

Click to download the PDB-style file with coordinates for d1p7ho2.
(The format of our PDB-style files is described here.)

Timeline for d1p7ho2: