| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Kruppel-like factor 3, Bklf [103597] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [103598] (3 PDB entries) |
| Domain d1p7aa_: 1p7a A: [94216] finger 3 complexed with zn |
PDB Entry: 1p7a (more details)
SCOPe Domain Sequences for d1p7aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}
gstrgstgikpfqcpdcdrsfsrsdhlalhrkrhmlv
Timeline for d1p7aa_: