Lineage for d1p7aa1 (1p7a A:7-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035191Protein Kruppel-like factor 3, Bklf [103597] (1 species)
  7. 3035192Species Mouse (Mus musculus) [TaxId:10090] [103598] (3 PDB entries)
  8. 3035194Domain d1p7aa1: 1p7a A:7-37 [94216]
    Other proteins in same PDB: d1p7aa2
    finger 3
    complexed with zn

Details for d1p7aa1

PDB Entry: 1p7a (more details)

PDB Description: solution structure of the third zinc finger from bklf
PDB Compounds: (A:) Kruppel-like factor 3

SCOPe Domain Sequences for d1p7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7aa1 g.37.1.1 (A:7-37) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}
tgikpfqcpdcdrsfsrsdhlalhrkrhmlv

SCOPe Domain Coordinates for d1p7aa1:

Click to download the PDB-style file with coordinates for d1p7aa1.
(The format of our PDB-style files is described here.)

Timeline for d1p7aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7aa2