Lineage for d1p7aa_ (1p7a A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429720Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 429721Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (3 families) (S)
  5. 429722Family g.37.1.1: Classic zinc finger, C2H2 [57668] (15 proteins)
  6. 429748Protein Kruppel-like factor 3, Bklf [103597] (1 species)
  7. 429749Species Mouse (Mus musculus) [TaxId:10090] [103598] (1 PDB entry)
  8. 429750Domain d1p7aa_: 1p7a A: [94216]
    finger 3
    complexed with zn

Details for d1p7aa_

PDB Entry: 1p7a (more details)

PDB Description: solution structure of the third zinc finger from bklf

SCOP Domain Sequences for d1p7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus)}
gstrgstgikpfqcpdcdrsfsrsdhlalhrkrhmlv

SCOP Domain Coordinates for d1p7aa_:

Click to download the PDB-style file with coordinates for d1p7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p7aa_: