Lineage for d1p7aa_ (1p7a A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892092Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 892093Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 892094Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 892126Protein Kruppel-like factor 3, Bklf [103597] (1 species)
  7. 892127Species Mouse (Mus musculus) [TaxId:10090] [103598] (3 PDB entries)
  8. 892128Domain d1p7aa_: 1p7a A: [94216]
    finger 3
    complexed with zn

Details for d1p7aa_

PDB Entry: 1p7a (more details)

PDB Description: solution structure of the third zinc finger from bklf
PDB Compounds: (A:) Kruppel-like factor 3

SCOP Domain Sequences for d1p7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}
gstrgstgikpfqcpdcdrsfsrsdhlalhrkrhmlv

SCOP Domain Coordinates for d1p7aa_:

Click to download the PDB-style file with coordinates for d1p7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p7aa_: