SCOPe 2.08: Domain d1p4ih_: 1p4i H:

Lineage for d1p4ih_ (1p4i H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1p4ih_: 1p4i H: [94104]
   Other proteins in same PDB: d1p4il_
   part of anti-GCN4 peptide scFv

Details for d1p4ih_

PDB Entry: 1p4i, 2.8 Å

PDB Description: Crystal Structure of scFv against peptide GCN4

PDB Compounds: (H:) Antibody Variable heavy chain

SCOPe Domain Sequences for d1p4ih_:

Sequence; same for both SEQRES and ATOM records:

>d1p4ih_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
dvqlqesgpglvapsqslsitctvsgfsltdygvnwvrqspgkglewlgviwgdgitdyn
salksrlsvtkdnsksqvflkmnslqsgdsaryycvtglfdywgqgttltvs

Timeline for d1p4ih_:

• d1p4ih_ first appeared in SCOP 1.67
  
• d1p4ih_ appears in SCOPe 2.07