PDB entry 1p4i

View 1p4i on RCSB PDB site
Description: Crystal Structure of scFv against peptide GCN4
Class: immune system
Keywords: peptide binder, scFv, picomolar binder, IMMUNE SYSTEM
Deposited on 2003-04-23, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody Variable heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4ih_
  • Chain 'L':
    Compound: Antibody Variable light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4il_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p4iH (H:)
    dvqlqesgpglvapsqslsitctvsgfsltdygvnwvrqspgkglewlgviwgdgitdyn
    salksrlsvtkdnsksqvflkmnslqsgdsaryycvtglfdywgqgttltvssasgadhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4iH (H:)
    dvqlqesgpglvapsqslsitctvsgfsltdygvnwvrqspgkglewlgviwgdgitdyn
    salksrlsvtkdnsksqvflkmnslqsgdsaryycvtglfdywgqgttltvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1p4iL (L:)
    madyadavvtqesalttspgetvtltcrsstgavttsnyaswvqekpdhlftgliggtnn
    rapgvparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgggggs
    ggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4iL (L:)
    adavvtqesalttspgetvtltcrsstgavttsnyaswvqekpdhlftgliggtnnrapg
    vparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl