Lineage for d1p45b_ (1p45 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 975885Protein Enoyl-ACP reductase [51791] (10 species)
  7. 975991Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (36 PDB entries)
  8. 976055Domain d1p45b_: 1p45 B: [94083]
    complexed with nad, tcl

Details for d1p45b_

PDB Entry: 1p45 (more details), 2.6 Å

PDB Description: targeting tuberculosis and malaria through inhibition of enoyl reductase: compound activity and structural data
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d1p45b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p45b_ c.2.1.2 (B:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d1p45b_:

Click to download the PDB-style file with coordinates for d1p45b_.
(The format of our PDB-style files is described here.)

Timeline for d1p45b_: