SCOP 1.67: Domain d1p3od_: 1p3o D:

Lineage for d1p3od_ (1p3o D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)

8. Domain d1p3od_: 1p3o D: [94052]
   Other proteins in same PDB: d1p3oa_, d1p3ob_, d1p3oc_, d1p3oe_, d1p3of_, d1p3og_

Details for d1p3od_

PDB Entry: 1p3o, 2.75 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3od_:

Sequence; same for both SEQRES and ATOM records:

>d1p3od_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
iqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1p3od_:

• d1p3od_ is new in SCOP 1.67
  
• d1p3od_ appears in SCOP 1.69
  
• d1p3od_ appears in the current release, SCOPe 2.08