Lineage for d1p3oc_ (1p3o C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353078Protein Histone H2A [47115] (4 species)
  7. 353079Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (19 PDB entries)
  8. 353102Domain d1p3oc_: 1p3o C: [94051]
    Other proteins in same PDB: d1p3oa_, d1p3ob_, d1p3od_, d1p3oe_, d1p3of_, d1p3oh_

Details for d1p3oc_

PDB Entry: 1p3o (more details), 2.75 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3oc_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis)}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

SCOP Domain Coordinates for d1p3oc_:

Click to download the PDB-style file with coordinates for d1p3oc_.
(The format of our PDB-style files is described here.)

Timeline for d1p3oc_: