Lineage for d1p3ld_ (1p3l D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987350Protein Histone H2B [47119] (6 species)
  7. 1987351Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (39 PDB entries)
  8. 1987364Domain d1p3ld_: 1p3l D: [94035]
    Other proteins in same PDB: d1p3la_, d1p3lb_, d1p3lc_, d1p3le_, d1p3lf_, d1p3lg_
    protein/DNA complex; mutant

Details for d1p3ld_

PDB Entry: 1p3l (more details), 2.4 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (D:) histone h2b

SCOPe Domain Sequences for d1p3ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ld_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
iqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d1p3ld_:

Click to download the PDB-style file with coordinates for d1p3ld_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ld_: