|  | Class a: All alpha proteins [46456] (202 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (3 families)  | 
|  | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones | 
|  | Protein Histone H3 [47122] (3 species) | 
|  | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries) | 
|  | Domain d1p3fa_: 1p3f A: [93998] Other proteins in same PDB: d1p3fb_, d1p3fc_, d1p3fd_, d1p3ff_, d1p3fg_, d1p3fh_ | 
PDB Entry: 1p3f (more details), 2.9 Å
SCOP Domain Sequences for d1p3fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3fa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis)}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1p3fa_: