Class a: All alpha proteins [46456] (202 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (4 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (19 PDB entries) |
Domain d1p3fg_: 1p3f G: [94004] Other proteins in same PDB: d1p3fa_, d1p3fb_, d1p3fd_, d1p3fe_, d1p3ff_, d1p3fh_ mutant |
PDB Entry: 1p3f (more details), 2.9 Å
SCOP Domain Sequences for d1p3fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3fg_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis)} kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
Timeline for d1p3fg_: