SCOPe 2.01: Domain d1p3ab_: 1p3a B:

Lineage for d1p3ab_ (1p3a B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)

8. Domain d1p3ab_: 1p3a B: [93981]
   Other proteins in same PDB: d1p3aa_, d1p3ac_, d1p3ad_, d1p3ae_, d1p3ag_, d1p3ah_
   protein/DNA complex; mutant

Details for d1p3ab_

PDB Entry: 1p3a, 3 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1p3ab_:

Sequence; same for both SEQRES and ATOM records:

>d1p3ab_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d1p3ab_:

• d1p3ab_ first appeared in SCOP 1.67
  
• d1p3ab_ appears in SCOP 1.75
  
• d1p3ab_ appears in SCOPe 2.02
  
• d1p3ab_ appears in the current release, SCOPe 2.08