Lineage for d1p34f_ (1p34 F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353235Protein Histone H4 [47125] (4 species)
  7. 353236Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)
  8. 353256Domain d1p34f_: 1p34 F: [93975]
    Other proteins in same PDB: d1p34a_, d1p34c_, d1p34d_, d1p34e_, d1p34g_, d1p34h_
    mutant

Details for d1p34f_

PDB Entry: 1p34 (more details), 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p34f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p34f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)}
lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
tamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1p34f_:

Click to download the PDB-style file with coordinates for d1p34f_.
(The format of our PDB-style files is described here.)

Timeline for d1p34f_: