SCOP 1.67: Domain d1p34b_: 1p34 B:

Lineage for d1p34b_ (1p34 B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)

8. Domain d1p34b_: 1p34 B: [93971]
   Other proteins in same PDB: d1p34a_, d1p34c_, d1p34d_, d1p34e_, d1p34g_, d1p34h_

Details for d1p34b_

PDB Entry: 1p34, 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p34b_:

Sequence; same for both SEQRES and ATOM records:

>d1p34b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

Timeline for d1p34b_:

• d1p34b_ is new in SCOP 1.67
  
• d1p34b_ appears in SCOP 1.69
  
• d1p34b_ appears in the current release, SCOPe 2.08