Lineage for d1oyza_ (1oyz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006796Family a.118.1.16: PBS lyase HEAT-like repeat [101410] (2 protein domains)
    Pfam PF03130
  6. 2006797Protein Hypothetical protein YibA [101411] (1 species)
  7. 2006798Species Escherichia coli [TaxId:562] [101412] (1 PDB entry)
  8. 2006799Domain d1oyza_: 1oyz A: [93775]

Details for d1oyza_

PDB Entry: 1oyz (more details), 2.1 Å

PDB Description: x-ray structure of yiba_ecoli northeast structural genomics consortium target et31.
PDB Compounds: (A:) Hypothetical protein yibA

SCOPe Domain Sequences for d1oyza_:

Sequence, based on SEQRES records: (download)

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}
yqkrkaskeyglynqckklnddelfrllddhnslkrissarvlqlrggqdavrlaiefcs
dknyirrdigafilgqikickkcednvfnilnnmalndksacvrataiestaqrckknpi
yspkiveqsqitafdkstnvrratafaisvindkatipllinllkdpngdvrnwaafain
inkydnsdirdcfvemlqdkneevrieaiiglsyrkdkrvlsvlcdelkkntvyddiiea
agelgdktllpvldtmlykfddneiitsaidklkrs

Sequence, based on observed residues (ATOM records): (download)

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}
yqkrkaskeyglynqckklnddelfrllddhnslkrissarvlqlrggqdavrlaiefcs
dknyirrdigafilgqikickkcednvfnilnnmalndksacvrataiestaqrckknpi
yspkiveqsqitafdkstnvrratafaisviatipllinllkdpngdvrnwaafainink
ydnsdirdcfvemlqdkneevrieaiiglsyrkdkrvlsvlcdelkkntvyddiieaage
lgdktllpvldtmlykfddneiitsaidklkrs

SCOPe Domain Coordinates for d1oyza_:

Click to download the PDB-style file with coordinates for d1oyza_.
(The format of our PDB-style files is described here.)

Timeline for d1oyza_: