![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
![]() | Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries) |
![]() | Domain d1oyxa1: 1oyx A:206-313 [93763] complexed with mes, so4 |
PDB Entry: 1oyx (more details), 1.85 Å
SCOPe Domain Sequences for d1oyxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyxa1 b.34.9.3 (A:206-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee
Timeline for d1oyxa1: