![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein Phenylacetic acid degradation protein PaaC [101136] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101137] (1 PDB entry) |
![]() | Domain d1otkb1: 1otk B:3-244 [93522] Other proteins in same PDB: d1otka2, d1otkb2 structural genomics |
PDB Entry: 1otk (more details), 2 Å
SCOPe Domain Sequences for d1otkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otkb1 a.25.1.2 (B:3-244) Phenylacetic acid degradation protein PaaC {Escherichia coli [TaxId: 562]} nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr vl
Timeline for d1otkb1: