Lineage for d1os6a_ (1os6 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449456Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 449457Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 449458Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 449497Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 449507Species Geobacter sulfurreducens [101502] (1 PDB entry)
  8. 449508Domain d1os6a_: 1os6 A: [93476]

Details for d1os6a_

PDB Entry: 1os6 (more details), 1.45 Å

PDB Description: cytochrome c7 (ppca) from geobacter sulfurreducens

SCOP Domain Sequences for d1os6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os6a_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Geobacter sulfurreducens}
addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheemkk
gptkcgechkk

SCOP Domain Coordinates for d1os6a_:

Click to download the PDB-style file with coordinates for d1os6a_.
(The format of our PDB-style files is described here.)

Timeline for d1os6a_: