PDB entry 1os6

View 1os6 on RCSB PDB site
Description: cytochrome c7 (ppca) from geobacter sulfurreducens
Deposited on 2003-03-18, released 2004-02-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.182
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1os6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1os6A (A:)
  addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheemkk
  gptkcgechkk