SCOPe 2.07: Domain d1oqqa_: 1oqq A:

Lineage for d1oqqa_ (1oqq A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)

8. Domain d1oqqa_: 1oqq A: [93422]
   complexed with fes; mutant

Details for d1oqqa_

PDB Entry: 1oqq, 1.47 Å

PDB Description: crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution

PDB Compounds: (A:) putidaredoxin

SCOPe Domain Sequences for d1oqqa_:

Sequence; same for both SEQRES and ATOM records:

>d1oqqa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

Timeline for d1oqqa_:

• d1oqqa_ first appeared in SCOP 1.67
  
• d1oqqa_ appears in SCOPe 2.06
  
• d1oqqa_ appears in the current release, SCOPe 2.08