Lineage for d1oqqa_ (1oqq A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408093Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 408094Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 408095Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 408137Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (6 PDB entries)
  8. 408138Domain d1oqqa_: 1oqq A: [93422]

Details for d1oqqa_

PDB Entry: 1oqq (more details), 1.47 Å

PDB Description: crystal structure of c73s/c85s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.47a resolution

SCOP Domain Sequences for d1oqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqqa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOP Domain Coordinates for d1oqqa_:

Click to download the PDB-style file with coordinates for d1oqqa_.
(The format of our PDB-style files is described here.)

Timeline for d1oqqa_: