Lineage for d1onqa2 (1onq A:7-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937558Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
  8. 2937559Domain d1onqa2: 1onq A:7-183 [93366]
    Other proteins in same PDB: d1onqa1, d1onqa3, d1onqb_, d1onqc1, d1onqc3, d1onqd_
    complexed with fuc, nag, slf

Details for d1onqa2

PDB Entry: 1onq (more details), 2.15 Å

PDB Description: crystal structure of cd1a in complex with a sulfatide
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1onqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onqa2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d1onqa2:

Click to download the PDB-style file with coordinates for d1onqa2.
(The format of our PDB-style files is described here.)

Timeline for d1onqa2: