Lineage for d1onqa2 (1onq A:7-183)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409345Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 409346Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (1 PDB entry)
  8. 409347Domain d1onqa2: 1onq A:7-183 [93366]
    Other proteins in same PDB: d1onqa1, d1onqb_, d1onqc1, d1onqd_

Details for d1onqa2

PDB Entry: 1onq (more details), 2.15 Å

PDB Description: Crystal Structure of CD1a in Complex with a Sulfatide

SCOP Domain Sequences for d1onqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onqa2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOP Domain Coordinates for d1onqa2:

Click to download the PDB-style file with coordinates for d1onqa2.
(The format of our PDB-style files is described here.)

Timeline for d1onqa2: