| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
| Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species) Class I MHC-related |
| Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (1 PDB entry) |
| Domain d1onqa2: 1onq A:7-183 [93366] Other proteins in same PDB: d1onqa1, d1onqb_, d1onqc1, d1onqd_ |
PDB Entry: 1onq (more details), 2.15 Å
SCOP Domain Sequences for d1onqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onqa2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d1onqa2:
View in 3DDomains from other chains: (mouse over for more information) d1onqb_, d1onqc1, d1onqc2, d1onqd_ |