Lineage for d1onlc_ (1onl C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082732Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2082733Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2082778Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2082799Species Thermus thermophilus [TaxId:274] [102003] (1 PDB entry)
  8. 2082802Domain d1onlc_: 1onl C: [93364]

Details for d1onlc_

PDB Entry: 1onl (more details), 2.5 Å

PDB Description: Crystal structure of Thermus thermophilus HB8 H-protein of the glycine cleavage system
PDB Compounds: (C:) glycine cleavage system H protein

SCOPe Domain Sequences for d1onlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onlc_ b.84.1.1 (C:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]}
dipkdrfytkthewalpegdtvlvgitdyaqdalgdvvyvelpevgrvvekgeavavves
vktasdiyapvageivevnlalektpelvnqdpygegwifrlkprdmgdldelldaggyq
evlesea

SCOPe Domain Coordinates for d1onlc_:

Click to download the PDB-style file with coordinates for d1onlc_.
(The format of our PDB-style files is described here.)

Timeline for d1onlc_: