Lineage for d1onkb2 (1onk B:138-263)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543501Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 1543514Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
    different sequence variants
    Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
  8. 1543518Domain d1onkb2: 1onk B:138-263 [93361]
    Other proteins in same PDB: d1onka_
    complexed with azi, gol, nag, po4

Details for d1onkb2

PDB Entry: 1onk (more details), 2.1 Å

PDB Description: mistletoe lectin i from viscum album
PDB Compounds: (B:) Galactose specific lectin I B chain

SCOPe Domain Sequences for d1onkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onkb2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesnggsvwvetcdssqknqkwalygdgsirpkqnqdqcltsgrd
svstvinivscsgasgsqrwvftnegailnlknglamdvaqanpklrriiiypatgkpnq
mwlpvf

SCOPe Domain Coordinates for d1onkb2:

Click to download the PDB-style file with coordinates for d1onkb2.
(The format of our PDB-style files is described here.)

Timeline for d1onkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1onkb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1onka_