SCOPe 2.07: Domain d1olqb_: 1olq B:

Lineage for d1olqb_ (1olq B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)

7. Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (3 PDB entries)

8. Domain d1olqb_: 1olq B: [93329]
   complexed with nag; mutant

Details for d1olqb_

PDB Entry: 1olq, 1.7 Å

PDB Description: the trichoderma reesei cel12a p201c mutant, structure at 1.7 a resolution

PDB Compounds: (B:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d1olqb_:

Sequence; same for both SEQRES and ATOM records:

>d1olqb_ b.29.1.11 (B:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A [TaxId: 51453]}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtecftgsgtlnvaswtasin

Timeline for d1olqb_:

• d1olqb_ first appeared in SCOP 1.67
  
• d1olqb_ appears in SCOPe 2.06
  
• d1olqb_ appears in the current release, SCOPe 2.08