Lineage for d1olqa_ (1olq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389729Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2389758Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (3 PDB entries)
  8. 2389765Domain d1olqa_: 1olq A: [93328]
    complexed with nag; mutant

Details for d1olqa_

PDB Entry: 1olq (more details), 1.7 Å

PDB Description: the trichoderma reesei cel12a p201c mutant, structure at 1.7 a resolution
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d1olqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olqa_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A [TaxId: 51453]}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtecftgsgtlnvaswtasin

SCOPe Domain Coordinates for d1olqa_:

Click to download the PDB-style file with coordinates for d1olqa_.
(The format of our PDB-style files is described here.)

Timeline for d1olqa_: