Lineage for d1okka1 (1okk A:4-88)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 910354Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 910355Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 910375Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 910386Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 910396Domain d1okka1: 1okk A:4-88 [93259]
    Other proteins in same PDB: d1okka2, d1okkd1, d1okkd2
    complexed with bzp, edo, gcp, mg, so4

Details for d1okka1

PDB Entry: 1okk (more details), 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1okka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okka1 a.24.13.1 (A:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
vlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d1okka1:

Click to download the PDB-style file with coordinates for d1okka1.
(The format of our PDB-style files is described here.)

Timeline for d1okka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okka2