SCOPe 2.08: Domain d1okka1: 1okk A:4-88

Lineage for d1okka1 (1okk A:4-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)

8. Domain d1okka1: 1okk A:4-88 [93259]
   Other proteins in same PDB: d1okka2, d1okkd1, d1okkd2
   complexed with bzp, edo, gcp, mg, so4

Details for d1okka1

PDB Entry: 1okk, 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1okka1:

Sequence; same for both SEQRES and ATOM records:

>d1okka1 a.24.13.1 (A:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
vlesltpaevilatvyealkealgg

Timeline for d1okka1:

• d1okka1 first appeared in SCOP 1.67
  
• d1okka1 appears in SCOPe 2.07