SCOPe 2.05: Domain d1okga1: 1okg A:7-162

Lineage for d1okga1 (1okg A:7-162)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species)

7. Species Leishmania major [TaxId:5664] [102428] (1 PDB entry)

8. Domain d1okga1: 1okg A:7-162 [93250]
   Other proteins in same PDB: d1okga3
   complexed with ca, so3

Details for d1okga1

PDB Entry: 1okg, 2.1 Å

PDB Description: 3-mercaptopyruvate sulfurtransferase from leishmania major

PDB Compounds: (A:) possible 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d1okga1:

Sequence; same for both SEQRES and ATOM records:

>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]}
apkhpgkvfldpsevadhlaeyrivdcryslkikdhgsiqyakehvksairadvdtnlsk
lvptstarhplppcaefidwcmangmagelpvlcyddecgamggcrlwwmlnslgadayv
inggfqackaaglemesgepsslprpathwpfktaf

Timeline for d1okga1:

• d1okga1 first appeared in SCOP 1.67
  
• d1okga1 appears in SCOPe 2.04
  
• d1okga1 appears in SCOPe 2.06
  
• d1okga1 appears in the current release, SCOPe 2.08