Lineage for d1okga1 (1okg A:7-162)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
    duplication: consists of two domains of this fold
  6. Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species)
  7. Species Leishmania major [TaxId:5664] [102428] (1 PDB entry)
  8. Domain d1okga1: 1okg A:7-162 [93250]
    Other proteins in same PDB: d1okga3
    complexed with ca, so3

Details for d1okga1

PDB Entry: 1okg (more details), 2.1 Å

PDB Description: 3-mercaptopyruvate sulfurtransferase from leishmania major
PDB Compounds: (A:) possible 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d1okga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]}
apkhpgkvfldpsevadhlaeyrivdcryslkikdhgsiqyakehvksairadvdtnlsk
lvptstarhplppcaefidwcmangmagelpvlcyddecgamggcrlwwmlnslgadayv
inggfqackaaglemesgepsslprpathwpfktaf

SCOPe Domain Coordinates for d1okga1 are not available.

Timeline for d1okga1:

Domains from same chain:
(mouse over for more information)
d1okga2, d1okga3